Skip to content
EVOHN

Growth / GHRH Analogue

Tesamorelin

A stabilised growth hormone-releasing factor analogue studied for somatotropic signalling.

Research domain
Growth
Presentation
10 mg / vial
Assayed purity
≥ 99% by HPLC
Evidence base
Established
Tesamorelin — Growth / GHRH Analogue

Also designatedGRF(1-44) analogue · TH9507 · Tesamorelin acetate

Quick facts

Purity specification
≥ 99% by HPLC
Physical form
Lyophilised powder
Presentation
10 mg / vial
Evidence base
Established
Intended use
Laboratory research only

Research overview

How it is characterised

Tesamorelin is a synthetic forty-four amino acid analogue of human growth hormone-releasing hormone, modified at the N-terminus with a trans-3-hexenoyl group that slows enzymatic cleavage relative to the native sequence. The published record characterises it as a receptor agonist acting on the pituitary somatotroph, and examines the pulsatile secretion pattern that follows from stimulating the axis at its physiological control point.

Mechanism

Described as binding the GHRH receptor on somatotrophs and raising intracellular cyclic AMP, increasing the amplitude of endogenous secretory pulses rather than imposing a continuous signal. The N-terminal modification is studied for the resistance to dipeptidyl peptidase-4 cleavage that extends the interval over which the analogue remains intact.

Applications

  • Somatotropic axis research
  • Neuroendocrine model characterisation
  • Comparative GHRH analogue studies
  • Peptide stability profiling

Research focus

Areas of published investigation

The following describe where this compound has been examined in the scientific literature. They are not claims of effect, and nothing here should be read as a therapeutic indication.

  • 01GHRH receptor signalling
  • 02Pulsatile secretion architecture
  • 03IGF-1 axis characterisation
  • 04Peptide stabilisation by N-terminal modification

Molecular & pharmacokinetic data

The physical record

Verify every figure against the certificate of analysis for the batch you hold. Where the label and the assay disagree, the assay is the number to calculate from.

CAS number
218949-48-5
Molecular formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molar mass
≈ 5135.86 g/mol
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARAR
Reported half-life
Short in circulation; extended relative to native GHRH
Solubility
Soluble in bacteriostatic water

Storage

Store lyophilised at −20 °C, protected from light and moisture. Following reconstitution, hold at 2–8 °C and use within the interval stated on the batch certificate of analysis.

Handling

Allow the vial to reach ambient temperature before breaking the seal so atmospheric moisture does not condense onto the cake. Introduce diluent slowly against the vial wall rather than directly onto the powder, and swirl rather than shake. Avoid repeated freeze-thaw cycles; aliquot where a preparation will be drawn on more than once.

Packaging

Amber borosilicate vial with butyl stopper and aluminium crimp seal, presented in a matte debossed box with die-cut foam insert and magnetic closure.

Selected references

The published record

A starting point rather than a survey. Entries are listed for orientation and do not constitute endorsement of any interpretation drawn from them.

  1. 01Growth hormone-releasing factor analogues and receptor activationJournal of Clinical Endocrinology & Metabolism, 2010
  2. 02Enzymatic stabilisation of GHRH by N-terminal modificationPeptides, 2012
  3. 03Pulsatility in the somatotropic axisEndocrine Reviews, 2016

This catalogue is presented for informational purposes only. It is not an offer of sale, and it makes no medical or therapeutic claim.

Enquiries

Request the batch documentation.

Ask a specialist about Tesamorelin — its current batch, analytical documentation, and what can be supplied to your territory.